Sohbet odaları ile sende kaliteli sohbetin tadını çıkar! Binlerce insan ile sohbet odalarında bir araya gelerek Türkiye'nin en çok tercih edilen sohbet sitesinde eğlen.

4.43 Rating by CuteStat

mirckelebek.com is 4 years 1 month old. It is a domain having com extension. It has a global traffic rank of #8137079 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, mirckelebek.com is SAFE to browse.

PageSpeed Score
77
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 103
Daily Pageviews: 206

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: 1

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 8,137,079
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

185.9.39.185

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: 2 H4 Headings: 1
H5 Headings: 3 H6 Headings: 1
Total IFRAMEs: Not Applicable Total Images: 9
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 185.9.39.185)

Okey4 Okey Oyna – Bedava Okeye4 Salonları

- okey4.org

Okey4 Sanal alemin en çok tercih edilen canlı okey oynama sitesi, üye olmadan bedava okey oyna, hemen okey oyununa katılın.

9,682,142 $ 240.00

HOSSOHBET.NET - Omegla Sohbet ve Chat Odaları

- hossohbet.net

hoş sohbet chat odaları, yılların verdiği birikim ve tecrübe ile sizlere en kaliteli Omegla sohbet sitesi hizmeti sunmaya devam ediyor.

5,859,013 $ 240.00

Chatruya.com - Chat, sohbet, sohbet odaları

- guncelsohbet.com

turkiyenin en geniş kapsamlı chat, sohbet, ve sohbet odaları bedava çet yapılan sohbet sitesidir

Not Applicable $ 8.95

SohbetBaz.Org - Canlı Chat Sohbet - Online Sohbet Odalari

- sohbetseli.org

Sohbetbaz.org Chat, Sohbet, Chat odaları, Chat Sohbet Aramalari icin Hizmet Veren Türkiyenin En iyi Sohbet Sitesidir..

Not Applicable $ 8.95

Kalbin.Net - Türkiyenin Mobil Sohbet Sitesi.

- kalbin.net

Türkiyenin en kaliteli mobil sohbet sitelerinden birisi olan Kalbin.Net'da şimdi hemen chat sohbete başlayın.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Link: <https://www.mirckelebek.com/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Sun, 29 Mar 2020 14:25:27 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="35,37,38,39"
Connection: Keep-Alive

Domain Information

Domain Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registration Date: Mar 20, 2020, 6:15 PM 4 years 1 month 1 day ago
Expiration Date: Mar 20, 2021, 6:15 PM 3 years 1 month 1 week ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns7.sekershell.com 185.9.39.181 Türkiye Türkiye
ns8.sekershell.com 185.9.39.182 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
mirckelebek.com A 10797 IP: 185.9.39.185
mirckelebek.com NS 86400 Target: ns8.sekershell.com
mirckelebek.com NS 86400 Target: ns7.sekershell.com
mirckelebek.com SOA 10800 MNAME: ns7.sekershell.com
RNAME: sekershellnet.gmail.com
Serial: 2020032004
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
mirckelebek.com MX 14400 Target: mirckelebek.com
mirckelebek.com TXT 14400 TXT: v=spf1 +a +mx +ip4:185.244.147.243 ~all

Similarly Ranked Websites

Stoltz Management

- investorportal.stoltzusa.com
8,137,080 $ 240.00

ecotopianetwork

- ecotopianetwork.wordpress.com
8,137,099 $ 240.00

Film izle, HD Film izle, Sinema izle, Film Seyret

- filmifullhdizlet.com

Yepyeni vizyona girmiş yerli ve yabancı filmleri ister türkçe dublaj ister türkçe altyazılı olarak izleyebileceğiniz muhteşem bir portal

8,137,101 $ 8.95

Completely FREE Software - Windows & DOS freeware

- completelyfreesoftware.com

Freeware heaven! A fabulous selection of completely free Windows & DOS software - tested, reviewed and rated.

8,137,108 $ 240.00

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Full WHOIS Lookup

Domain Name: MIRCKELEBEK.COM
Registry Domain ID: 2505336289_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.aerotek.com.tr
Registrar URL:
Updated Date: 2020-03-20T12:30:22Z
Creation Date: 2020-03-20T12:30:21Z
Registrar Registration Expiration Date: 2021-03-20T12:30:21Z
Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registrar IANA ID: 1534
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@privacyprotect.org
Name Server: ns7.sekershell.com
Name Server: ns8.sekershell.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: logicbox@aerotek.com.tr
Registrar Abuse Contact Phone: +90.2623245555
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-29T14:25:43Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: AEROTEK

PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to
protect the owner from spam and phishing attacks. PrivacyProtect.org is not
responsible for any of the activities associated with this domain name. If you wish
to report any abuse concerning the usage of this domain name, you may do so at
http://privacyprotect.org/contact. We have a stringent abuse policy and any
complaint will be actioned within a short period of time.

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Aerotek Bilisim Sanayi ve Ticaret AS.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.